List Of Integrated Circuits Manufacturers

Iccapacitorregisterconnectorsinterconnectsintegrated circuitsphiwinbondcentillricohnuvotonstsonyissipmcamdnslinearmarvellstmamccfreescaleatmelgsicirrus logic inczilognational semiconductorintersilfairchild. Non exhaustive list of manufacturers which make or have made these kind of circuits.

Top Semiconductor Companies 50 Semiconductor Companies In

Circuit Board Parts The Most Comprehensive Introduction Is

List Of Semiconductor Companies In India Soft Tell

Agilent technologies formerly part of hewlett packard spun off in 1999.

List of integrated circuits manufacturers. Airgo networks acquired by qualcomm in. List of integrated circuit manufacturers achronix. The following is a list of 7400 series digital logic integrated circuits.

The prinztronic c20 uses the cal tex ct5002 integrated circuit. On semiconductor fairchild semiconductor. Due to the popularity of these parts other manufacturers released pin to pin compatible logic devices which kept the 7400 sequence number as an aid to identification of compatible parts.

Find integrated circuit manufacturers from china. Texas instruments based out of the united states manufactures analog power management and signal chain integrated circuits. Import quality integrated circuit supplied by experienced manufacturers at global sources.

We use cookies to give you the best possible experience on our website. The original 7400 series integrated circuits were made by texas instruments with the prefix sn to create the name sn74xx. Agere systems now part of lsi logic formerly part of lucent which was formerly part of att.

For more details including how to change your cookie settings. Analog devices also based out of the us provides analog amplifier converter audio video interface isolation power monitoring and control rf microwave sensor mems switch and multiplexer integrated circuits. The major calculator manufacturer commodore took the opportunity for vertical integration by buying mos technology one of its suppliers of calculator integrated circuits.